SCOPe 2.06: Domain d2d7cd_: 2d7c D:

Lineage for d2d7cd_ (2d7c D:)

1. Root: SCOPe 2.06

2. Class h: Coiled coil proteins [57942] (7 folds)

3. Fold h.1: Parallel coiled-coil [57943] (38 superfamilies)
   this is not a true fold; includes oligomers of shorter identical helices

4. Superfamily h.1.31: Eferin C-derminal domain-like [144270] (1 family)

5. Family h.1.31.1: Eferin C-derminal domain-like [144271] (3 proteins)
   contains PfamB PB042332, PfamB PB026102

6. Protein Rab11 family-interacting protein 3 (Rab11-FIP3, Eferin) [144274] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [144275] (2 PDB entries)
   Uniprot O75154 703-756! Uniprot O75154 715-756

8. Domain d2d7cd_: 2d7c D: [131320]
   Other proteins in same PDB: d2d7ca_, d2d7cb_
   automated match to d2d7cc1
   complexed with gtp, mes, mg

Details for d2d7cd_

PDB Entry: 2d7c, 1.75 Å

PDB Description: crystal structure of human rab11 in complex with fip3 rab-binding domain

PDB Compounds: (D:) Rab11 family-interacting protein 3

SCOPe Domain Sequences for d2d7cd_:

Sequence; same for both SEQRES and ATOM records:

>d2d7cd_ h.1.31.1 (D:) Rab11 family-interacting protein 3 (Rab11-FIP3, Eferin) {Human (Homo sapiens) [TaxId: 9606]}
vsrdelmeaiqkqeeinfrlqdyidriivaimetnpsilevk

Timeline for d2d7cd_:

• d2d7cd_ first appeared in SCOP 1.73, called d2d7cd1
  
• d2d7cd_ appears in SCOPe 2.05
  
• d2d7cd_ appears in SCOPe 2.07
  
• d2d7cd_ appears in the current release, SCOPe 2.08