SCOPe 2.03: Domain d2d7cc1: 2d7c C:715-756

Lineage for d2d7cc1 (2d7c C:715-756)

1. Root: SCOPe 2.03

2. Class h: Coiled coil proteins [57942] (7 folds)

3. Fold h.1: Parallel coiled-coil [57943] (34 superfamilies)
   this is not a true fold; includes oligomers of shorter identical helices

4. Superfamily h.1.31: Eferin C-derminal domain-like [144270] (1 family)

5. Family h.1.31.1: Eferin C-derminal domain-like [144271] (2 proteins)
   contains PfamB PB042332, PfamB PB026102

6. Protein Rab11 family-interacting protein 3 (Rab11-FIP3, Eferin) [144274] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [144275] (2 PDB entries)
   Uniprot O75154 703-756! Uniprot O75154 715-756

8. Domain d2d7cc1: 2d7c C:715-756 [131319]
   Other proteins in same PDB: d2d7ca_, d2d7cb_
   complexed with gtp, mes, mg

Details for d2d7cc1

PDB Entry: 2d7c, 1.75 Å

PDB Description: crystal structure of human rab11 in complex with fip3 rab-binding domain

PDB Compounds: (C:) Rab11 family-interacting protein 3

SCOPe Domain Sequences for d2d7cc1:

Sequence; same for both SEQRES and ATOM records:

>d2d7cc1 h.1.31.1 (C:715-756) Rab11 family-interacting protein 3 (Rab11-FIP3, Eferin) {Human (Homo sapiens) [TaxId: 9606]}
vsrdelmeaiqkqeeinfrlqdyidriivaimetnpsilevk

Timeline for d2d7cc1:

• d2d7cc1 first appeared in SCOP 1.73
  
• d2d7cc1 appears in SCOPe 2.02
  
• d2d7cc1 appears in SCOPe 2.04
  
• d2d7cc1 appears in the current release, SCOPe 2.08