Lineage for d2d7ca1 (2d7c A:8-173)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 695085Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 695086Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (24 families) (S)
    division into families based on beta-sheet topologies
  5. 695634Family c.37.1.8: G proteins [52592] (78 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 696065Protein Rab11a [102362] (1 species)
  7. 696066Species Human (Homo sapiens) [TaxId:9606] [102363] (9 PDB entries)
  8. 696067Domain d2d7ca1: 2d7c A:8-173 [131317]
    Other proteins in same PDB: d2d7cc1, d2d7cd1
    automatically matched to d1oiwa_
    complexed with gtp, mes, mg; mutant

Details for d2d7ca1

PDB Entry: 2d7c (more details), 1.75 Å

PDB Description: crystal structure of human rab11 in complex with fip3 rab-binding domain
PDB Compounds: (A:) Ras-related protein Rab-11A

SCOP Domain Sequences for d2d7ca1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2d7ca1 c.37.1.8 (A:8-173) Rab11a {Human (Homo sapiens) [TaxId: 9606]}
ydylfkvvligdsgvgksnllsrftrnefnleskstigvefatrsiqvdgktikaqiwdt
agleryraitsayyrgavgallvydiakhltyenverwlkelrdhadsnivimlvgnksd
lrhlravptdearafaeknglsfietsaldstnveaafqtilteiy

SCOP Domain Coordinates for d2d7ca1:

Click to download the PDB-style file with coordinates for d2d7ca1.
(The format of our PDB-style files is described here.)

Timeline for d2d7ca1: