Lineage for d2d6fd2 (2d6f D:271-395)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 865191Fold d.74: DCoH-like [55247] (5 superfamilies)
    beta(2)-alpha-beta(2)-alpha; 2 layers, alpha/beta
  4. 865389Superfamily d.74.4: GAD domain-like [55261] (2 families) (S)
  5. 865390Family d.74.4.1: GAD domain [55262] (2 proteins)
    has additional structures inserted in the common fold loops
  6. 865391Protein Glutamyl-tRNA(gln) amidotransferase subunit E, GatE, insert domain [143513] (2 species)
  7. 865392Species Methanobacterium thermoautotrophicum [TaxId:145262] [143514] (1 PDB entry)
    Uniprot O26803 271-395
  8. 865394Domain d2d6fd2: 2d6f D:271-395 [131311]
    Other proteins in same PDB: d2d6fa1, d2d6fa2, d2d6fb1, d2d6fb2, d2d6fc1, d2d6fc3, d2d6fd1, d2d6fd3
    automatically matched to 2D6F C:271-395
    complexed with zn

Details for d2d6fd2

PDB Entry: 2d6f (more details), 3.15 Å

PDB Description: Crystal structure of Glu-tRNA(Gln) amidotransferase in the complex with tRNA(Gln)
PDB Compounds: (D:) Glutamyl-tRNA(Gln) amidotransferase subunit E

SCOP Domain Sequences for d2d6fd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2d6fd2 d.74.4.1 (D:271-395) Glutamyl-tRNA(gln) amidotransferase subunit E, GatE, insert domain {Methanobacterium thermoautotrophicum [TaxId: 145262]}
avvedkifdvsevfadtesriissaesvlavklrgfdgligveiqpgrrlgtemadyakk
rgvsgifhtdelpaygiteeevrglrdavgasqgdavvmvahervtaenalrevirraem
aiqgv

SCOP Domain Coordinates for d2d6fd2:

Click to download the PDB-style file with coordinates for d2d6fd2.
(The format of our PDB-style files is described here.)

Timeline for d2d6fd2: