Lineage for d2d6fb1 (2d6f B:2-73)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 666911Fold b.38: Sm-like fold [50181] (3 superfamilies)
    core: barrel, open; n*=4, S*=8; meander; SH3-like topology
  4. 667229Superfamily b.38.3: GatD N-terminal domain-like [141300] (1 family) (S)
  5. 667230Family b.38.3.1: GatD N-terminal domain-like [141301] (1 protein)
    PfamB 010580
  6. 667231Protein Glutamyl-tRNA(Gln) amidotransferase subunit D, GatD [141302] (2 species)
  7. 667232Species Methanobacterium thermoautotrophicum [TaxId:145262] [141304] (1 PDB entry)
  8. 667234Domain d2d6fb1: 2d6f B:2-73 [131305]
    Other proteins in same PDB: d2d6fa2, d2d6fb2, d2d6fc1, d2d6fc2, d2d6fc3, d2d6fd1, d2d6fd2, d2d6fd3
    automatically matched to 2D6F A:2-73
    complexed with zn

Details for d2d6fb1

PDB Entry: 2d6f (more details), 3.15 Å

PDB Description: Crystal structure of Glu-tRNA(Gln) amidotransferase in the complex with tRNA(Gln)
PDB Compounds: (B:) Glutamyl-tRNA(Gln) amidotransferase subunit D

SCOP Domain Sequences for d2d6fb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2d6fb1 b.38.3.1 (B:2-73) Glutamyl-tRNA(Gln) amidotransferase subunit D, GatD {Methanobacterium thermoautotrophicum [TaxId: 145262]}
syqgrarkflesasidvgdmvlvekpdvtyegmvldraddaddrhivlklengynigvei
sdariellekgs

SCOP Domain Coordinates for d2d6fb1:

Click to download the PDB-style file with coordinates for d2d6fb1.
(The format of our PDB-style files is described here.)

Timeline for d2d6fb1: