![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.38: Sm-like fold [50181] (5 superfamilies) core: barrel, open; n*=4, S*=8; meander; SH3-like topology |
![]() | Superfamily b.38.3: GatD N-terminal domain-like [141300] (2 families) ![]() |
![]() | Domain d2d6fb1: 2d6f B:2-73 [131305] Other proteins in same PDB: d2d6fa1, d2d6fa2, d2d6fb2, d2d6fc1, d2d6fc2, d2d6fc3, d2d6fd1, d2d6fd2, d2d6fd3 automated match to d2d6fa1 protein/RNA complex; complexed with zn |
PDB Entry: 2d6f (more details), 3.15 Å
SCOPe Domain Sequences for d2d6fb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2d6fb1 b.38.3.0 (B:2-73) automated matches {Methanothermobacter thermautotrophicus [TaxId: 145262]} syqgrarkflesasidvgdmvlvekpdvtyegmvldraddaddrhivlklengynigvei sdariellekgs
Timeline for d2d6fb1: