Lineage for d2d6fa1 (2d6f A:2-73)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2396390Fold b.38: Sm-like fold [50181] (5 superfamilies)
    core: barrel, open; n*=4, S*=8; meander; SH3-like topology
  4. 2397370Superfamily b.38.3: GatD N-terminal domain-like [141300] (2 families) (S)
  5. 2397371Family b.38.3.1: GatD N-terminal domain-like [141301] (1 protein)
    PfamB PB010580
  6. 2397372Protein Glutamyl-tRNA(Gln) amidotransferase subunit D, GatD [141302] (2 species)
  7. 2397373Species Methanobacterium thermoautotrophicum [TaxId:145262] [141304] (1 PDB entry)
    Uniprot O26802 2-73
  8. 2397374Domain d2d6fa1: 2d6f A:2-73 [131303]
    Other proteins in same PDB: d2d6fa2, d2d6fb1, d2d6fb2, d2d6fc1, d2d6fc2, d2d6fc3, d2d6fd1, d2d6fd2, d2d6fd3
    protein/RNA complex; complexed with zn

Details for d2d6fa1

PDB Entry: 2d6f (more details), 3.15 Å

PDB Description: Crystal structure of Glu-tRNA(Gln) amidotransferase in the complex with tRNA(Gln)
PDB Compounds: (A:) Glutamyl-tRNA(Gln) amidotransferase subunit D

SCOPe Domain Sequences for d2d6fa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2d6fa1 b.38.3.1 (A:2-73) Glutamyl-tRNA(Gln) amidotransferase subunit D, GatD {Methanobacterium thermoautotrophicum [TaxId: 145262]}
syqgrarkflesasidvgdmvlvekpdvtyegmvldraddaddrhivlklengynigvei
sdariellekgs

SCOPe Domain Coordinates for d2d6fa1:

Click to download the PDB-style file with coordinates for d2d6fa1.
(The format of our PDB-style files is described here.)

Timeline for d2d6fa1: