Lineage for d2d69b1 (2d69 B:134-425)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2838499Superfamily c.1.14: RuBisCo, C-terminal domain [51649] (2 families) (S)
    automatically mapped to Pfam PF00016
  5. 2838500Family c.1.14.1: RuBisCo, large subunit, C-terminal domain [51650] (2 proteins)
    N-terminal domain is alpha+beta
  6. 2838501Protein Ribulose 1,5-bisphosphate carboxylase-oxygenase [51651] (14 species)
  7. 2838586Species Pyrococcus horikoshii [TaxId:53953] [141850] (3 PDB entries)
    Uniprot O58677 134-424
  8. 2838588Domain d2d69b1: 2d69 B:134-425 [131294]
    Other proteins in same PDB: d2d69a2, d2d69b2, d2d69d2, d2d69e2
    automated match to d2cwxa1
    complexed with so4

Details for d2d69b1

PDB Entry: 2d69 (more details), 1.9 Å

PDB Description: Crystal structure of the complex of sulfate ion and octameric ribulose-1,5-bisphosphate carboxylase/oxygenase (Rubisco) from Pyrococcus horikoshii OT3 (form-2 crystal)
PDB Compounds: (B:) Ribulose bisphosphate carboxylase

SCOPe Domain Sequences for d2d69b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2d69b1 c.1.14.1 (B:134-425) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Pyrococcus horikoshii [TaxId: 53953]}
kgpqfgvqgirefmgvkdrpltatvpkpkmgwsveeyaeiayelwsggidllkddenfts
fpfnrfeervrklyrvrdrveaetgetkeylinitgpvnimekraemvaneggqyvmidi
vvagwsalqymrevtedlglaihahramhaaftrnprhgitmlalakaarmigvdqihtg
tavgkmagnyeeikrindfllskwehirpvfpvasgglhpglmpelirlfgkdlviqagg
gvmghpdgpragakalrdaidaaiegvdldekaksspelkkslrevglskak

SCOPe Domain Coordinates for d2d69b1:

Click to download the PDB-style file with coordinates for d2d69b1.
(The format of our PDB-style files is described here.)

Timeline for d2d69b1: