Class a: All alpha proteins [46456] (289 folds) |
Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
Superfamily a.1.1: Globin-like [46458] (5 families) |
Family a.1.1.2: Globins [46463] (27 proteins) Heme-binding protein |
Protein Hemoglobin, alpha-chain [46486] (24 species) |
Species Human (Homo sapiens) [TaxId:9606] [46487] (253 PDB entries) Uniprot P69905 P01922 P01934 P01935 |
Domain d2d60c_: 2d60 C: [131290] Other proteins in same PDB: d2d60b_, d2d60d_ automated match to d1a00a_ complexed with hem, l35 |
PDB Entry: 2d60 (more details), 1.7 Å
SCOPe Domain Sequences for d2d60c_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2d60c_ a.1.1.2 (C:) Hemoglobin, alpha-chain {Human (Homo sapiens) [TaxId: 9606]} vlspadktnvkaawgkvgahageygaealermflsfpttktyfphfdlshgsaqvkghgk kvadaltnavahvddmpnalsalsdlhahklrvdpvnfkllshcllvtlaahlpaeftpa vhasldkflasvstvltskyr
Timeline for d2d60c_: