Lineage for d2d32c_ (2d32 C:)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1040112Fold d.128: Glutamine synthetase/guanido kinase [55930] (1 superfamily)
    duplication: common core consists of two beta-alpha-beta2-alpha repeats
  4. 1040113Superfamily d.128.1: Glutamine synthetase/guanido kinase [55931] (5 families) (S)
  5. 1040297Family d.128.1.4: Glutamate-cysteine ligase [118090] (2 proteins)
    Pfam PF04262
  6. 1040306Protein automated matches [190259] (1 species)
    not a true protein
  7. 1040307Species Escherichia coli [TaxId:562] [187046] (2 PDB entries)
  8. 1040310Domain d2d32c_: 2d32 C: [131196]
    automated match to d1v4ga_
    complexed with anp, cys, glu, mg

Details for d2d32c_

PDB Entry: 2d32 (more details), 2.4 Å

PDB Description: Crystal Structure of Michaelis Complex of gamma-Glutamylcysteine Synthetase
PDB Compounds: (C:) Glutamate--cysteine ligase

SCOPe Domain Sequences for d2d32c_:

Sequence, based on SEQRES records: (download)

>d2d32c_ d.128.1.4 (C:) automated matches {Escherichia coli [TaxId: 562]}
mipdvsqalawlekhpqalkgiqrgleretlrvnadgtlattghpealgsalthkwittd
faeallefitpvdgdiehmltfmrdlhrytarnmgdermwplsmpsyiaegqdielaqyg
tsntgrfktlyreglknrygalmqtisgvhynfslpmafwqaksgdisgadakekisagy
frvirnyyrfgwvipylfgaspaisssflqgkptslpfektesgmyylpyatslrlsdlg
ytnksqsnlgitfndlyeyvaglkqaiktpseeyakigiekdgkrlqinsnvlqienely
apirpkrvtrsgespsdallrggieyievrsldinpfspigvdeqqvrfldlfmvwcala
dapemssselactrvnwnrvilegrkpgltlgigcetaqfplpqvgkdlfrdlkrvaqtl
dsinggeayqkvcdelvacfdnpdltfsarilrsmidtgiggtgkafaeayrnllreepl
eilreedfvaereaserrqqemeaadtepfavwlek

Sequence, based on observed residues (ATOM records): (download)

>d2d32c_ d.128.1.4 (C:) automated matches {Escherichia coli [TaxId: 562]}
mipdvsqalawlekhpqalkgiqrgleretlrvnadgtlattghpealgsalthkwittd
faeallefitpvdgdiehmltfmrdlhrytarnmgdermwplsmpsyiadielaqygtsn
tgrfktlyreglknrygalmqtisgvhynfslpmafwqakisgadakekisagyfrvirn
yyrfgwvipylfgaspaisssfslpfektmyylpyatslrlsdlgytnqsnlgitfndly
eyvaglkqaiktpseeyakigiekdgkrlqinsnvlqienelyapirpkrvtrsgespsd
allrggieyievrsldinpfspigvdeqqvrfldlfmvwcaladapemssselactrvnw
nrvilegrkpgltlgigcetaqfplpqvgkdlfrdlkrvaqtldsinggeayqkvcdelv
acfdnpdltfsarilrsmidtgiggtgkafaeayrnllreepleilreedfvaereaser
rqqemeaadtepfavwlek

SCOPe Domain Coordinates for d2d32c_:

Click to download the PDB-style file with coordinates for d2d32c_.
(The format of our PDB-style files is described here.)

Timeline for d2d32c_: