Lineage for d2d32c1 (2d32 C:1-516)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 872298Fold d.128: Glutamine synthetase/guanido kinase [55930] (1 superfamily)
    duplication: common core consists of two beta-alpha-beta2-alpha repeats
  4. 872299Superfamily d.128.1: Glutamine synthetase/guanido kinase [55931] (5 families) (S)
  5. 872483Family d.128.1.4: Glutamate-cysteine ligase [118090] (1 protein)
    Pfam PF04262
  6. 872484Protein Gamma-glutamylcysteine synthetase GshA [118091] (1 species)
  7. 872485Species Escherichia coli [TaxId:562] [118092] (4 PDB entries)
    Uniprot P0A6W9
  8. 872488Domain d2d32c1: 2d32 C:1-516 [131196]
    automatically matched to d1v4ga_
    complexed with anp, cys, glu, mg; mutant

Details for d2d32c1

PDB Entry: 2d32 (more details), 2.4 Å

PDB Description: crystal structure of michaelis complex of gamma-glutamylcysteine synthetase
PDB Compounds: (C:) Glutamate--cysteine ligase

SCOP Domain Sequences for d2d32c1:

Sequence, based on SEQRES records: (download)

>d2d32c1 d.128.1.4 (C:1-516) Gamma-glutamylcysteine synthetase GshA {Escherichia coli [TaxId: 562]}
mipdvsqalawlekhpqalkgiqrgleretlrvnadgtlattghpealgsalthkwittd
faeallefitpvdgdiehmltfmrdlhrytarnmgdermwplsmpsyiaegqdielaqyg
tsntgrfktlyreglknrygalmqtisgvhynfslpmafwqaksgdisgadakekisagy
frvirnyyrfgwvipylfgaspaisssflqgkptslpfektesgmyylpyatslrlsdlg
ytnksqsnlgitfndlyeyvaglkqaiktpseeyakigiekdgkrlqinsnvlqienely
apirpkrvtrsgespsdallrggieyievrsldinpfspigvdeqqvrfldlfmvwcala
dapemssselactrvnwnrvilegrkpgltlgigcetaqfplpqvgkdlfrdlkrvaqtl
dsinggeayqkvcdelvacfdnpdltfsarilrsmidtgiggtgkafaeayrnllreepl
eilreedfvaereaserrqqemeaadtepfavwlek

Sequence, based on observed residues (ATOM records): (download)

>d2d32c1 d.128.1.4 (C:1-516) Gamma-glutamylcysteine synthetase GshA {Escherichia coli [TaxId: 562]}
mipdvsqalawlekhpqalkgiqrgleretlrvnadgtlattghpealgsalthkwittd
faeallefitpvdgdiehmltfmrdlhrytarnmgdermwplsmpsyiadielaqygtsn
tgrfktlyreglknrygalmqtisgvhynfslpmafwqakisgadakekisagyfrvirn
yyrfgwvipylfgaspaisssfslpfektmyylpyatslrlsdlgytnqsnlgitfndly
eyvaglkqaiktpseeyakigiekdgkrlqinsnvlqienelyapirpkrvtrsgespsd
allrggieyievrsldinpfspigvdeqqvrfldlfmvwcaladapemssselactrvnw
nrvilegrkpgltlgigcetaqfplpqvgkdlfrdlkrvaqtldsinggeayqkvcdelv
acfdnpdltfsarilrsmidtgiggtgkafaeayrnllreepleilreedfvaereaser
rqqemeaadtepfavwlek

SCOP Domain Coordinates for d2d32c1:

Click to download the PDB-style file with coordinates for d2d32c1.
(The format of our PDB-style files is described here.)

Timeline for d2d32c1: