Lineage for d2d2qb2 (2d2q B:199-297)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 672997Fold b.55: PH domain-like barrel [50728] (2 superfamilies)
    barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix
  4. 672998Superfamily b.55.1: PH domain-like [50729] (12 families) (S)
  5. 673327Family b.55.1.5: Third domain of FERM [50776] (8 proteins)
  6. 673355Protein Radixin [50779] (1 species)
  7. 673356Species Mouse (Mus musculus) [TaxId:10090] [50780] (7 PDB entries)
  8. 673368Domain d2d2qb2: 2d2q B:199-297 [131186]
    Other proteins in same PDB: d2d2qa1, d2d2qa3, d2d2qb1, d2d2qb3
    automatically matched to d1gc6a2

Details for d2d2qb2

PDB Entry: 2d2q (more details), 2.8 Å

PDB Description: Crystal structure of the dimerized radixin FERM domain
PDB Compounds: (B:) Radixin

SCOP Domain Sequences for d2d2qb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2d2qb2 b.55.1.5 (B:199-297) Radixin {Mouse (Mus musculus) [TaxId: 10090]}
emygvnyfeiknkkgtelwlgvdalglniyehddkltpkigfpwseirnisfndkkfvik
pidkkapdfvfyaprlrinkrilalcmgnhelymrrrkp

SCOP Domain Coordinates for d2d2qb2:

Click to download the PDB-style file with coordinates for d2d2qb2.
(The format of our PDB-style files is described here.)

Timeline for d2d2qb2: