Lineage for d2d2qa3 (2d2q A:3-87)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 717080Fold d.15: beta-Grasp (ubiquitin-like) [54235] (13 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 717081Superfamily d.15.1: Ubiquitin-like [54236] (7 families) (S)
  5. 717395Family d.15.1.4: First domain of FERM [54256] (6 proteins)
  6. 717423Protein Radixin [54259] (1 species)
  7. 717424Species Mouse (Mus musculus) [TaxId:10090] [54260] (7 PDB entries)
  8. 717435Domain d2d2qa3: 2d2q A:3-87 [131184]
    Other proteins in same PDB: d2d2qa1, d2d2qa2, d2d2qb1, d2d2qb2
    automatically matched to d1gc6a3

Details for d2d2qa3

PDB Entry: 2d2q (more details), 2.8 Å

PDB Description: Crystal structure of the dimerized radixin FERM domain
PDB Compounds: (A:) Radixin

SCOP Domain Sequences for d2d2qa3:

Sequence; same for both SEQRES and ATOM records: (download)

>d2d2qa3 d.15.1.4 (A:3-87) Radixin {Mouse (Mus musculus) [TaxId: 10090]}
kpinvrvttmdaelefaiqpnttgkqlfdqvvktvglrevwffglqyvdskgystwlkln
kkvtqqdvkkenplqfkfrakffpe

SCOP Domain Coordinates for d2d2qa3:

Click to download the PDB-style file with coordinates for d2d2qa3.
(The format of our PDB-style files is described here.)

Timeline for d2d2qa3: