SCOPe 2.08: Domain d2d2qa3: 2d2q A:3-87

Lineage for d2d2qa3 (2d2q A:3-87)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.1: Ubiquitin-like [54236] (11 families)

5. Family d.15.1.0: automated matches [191343] (1 protein)
   not a true family

6. Protein automated matches [190233] (31 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [189205] (17 PDB entries)

8. Domain d2d2qa3: 2d2q A:3-87 [131184]
   Other proteins in same PDB: d2d2qa1, d2d2qa2, d2d2qb1, d2d2qb2
   automated match to d1gc7a3

Details for d2d2qa3

PDB Entry: 2d2q, 2.8 Å

PDB Description: Crystal structure of the dimerized radixin FERM domain

PDB Compounds: (A:) Radixin

SCOPe Domain Sequences for d2d2qa3:

Sequence; same for both SEQRES and ATOM records:

>d2d2qa3 d.15.1.0 (A:3-87) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
kpinvrvttmdaelefaiqpnttgkqlfdqvvktvglrevwffglqyvdskgystwlkln
kkvtqqdvkkenplqfkfrakffpe

Timeline for d2d2qa3:

• d2d2qa3 first appeared in SCOP 1.73
  
• d2d2qa3 appears in SCOPe 2.07