Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
Superfamily d.15.1: Ubiquitin-like [54236] (11 families) |
Family d.15.1.0: automated matches [191343] (1 protein) not a true family |
Protein automated matches [190233] (31 species) not a true protein |
Species Mouse (Mus musculus) [TaxId:10090] [189205] (17 PDB entries) |
Domain d2d2qa3: 2d2q A:3-87 [131184] Other proteins in same PDB: d2d2qa1, d2d2qa2, d2d2qb1, d2d2qb2 automated match to d1gc7a3 |
PDB Entry: 2d2q (more details), 2.8 Å
SCOPe Domain Sequences for d2d2qa3:
Sequence; same for both SEQRES and ATOM records: (download)
>d2d2qa3 d.15.1.0 (A:3-87) automated matches {Mouse (Mus musculus) [TaxId: 10090]} kpinvrvttmdaelefaiqpnttgkqlfdqvvktvglrevwffglqyvdskgystwlkln kkvtqqdvkkenplqfkfrakffpe
Timeline for d2d2qa3: