Class b: All beta proteins [48724] (174 folds) |
Fold b.55: PH domain-like barrel [50728] (2 superfamilies) barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix |
Superfamily b.55.1: PH domain-like [50729] (13 families) |
Family b.55.1.5: Third domain of FERM [50776] (8 proteins) |
Protein Radixin [50779] (1 species) |
Species Mouse (Mus musculus) [TaxId:10090] [50780] (10 PDB entries) |
Domain d2d2qa2: 2d2q A:199-297 [131183] Other proteins in same PDB: d2d2qa1, d2d2qa3, d2d2qb1, d2d2qb3 automatically matched to d1gc6a2 |
PDB Entry: 2d2q (more details), 2.8 Å
SCOP Domain Sequences for d2d2qa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2d2qa2 b.55.1.5 (A:199-297) Radixin {Mouse (Mus musculus) [TaxId: 10090]} emygvnyfeiknkkgtelwlgvdalglniyehddkltpkigfpwseirnisfndkkfvik pidkkapdfvfyaprlrinkrilalcmgnhelymrrrkp
Timeline for d2d2qa2: