Class b: All beta proteins [48724] (180 folds) |
Fold b.55: PH domain-like barrel [50728] (3 superfamilies) barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix |
Superfamily b.55.1: PH domain-like [50729] (14 families) |
Family b.55.1.0: automated matches [191311] (1 protein) not a true family |
Protein automated matches [190052] (8 species) not a true protein |
Species Mouse (Mus musculus) [TaxId:10090] [232271] (6 PDB entries) |
Domain d2d2qa2: 2d2q A:199-299 [131183] Other proteins in same PDB: d2d2qa1, d2d2qa3, d2d2qb1, d2d2qb3 automated match to d2zpya2 |
PDB Entry: 2d2q (more details), 2.8 Å
SCOPe Domain Sequences for d2d2qa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2d2qa2 b.55.1.0 (A:199-299) automated matches {Mouse (Mus musculus) [TaxId: 10090]} emygvnyfeiknkkgtelwlgvdalglniyehddkltpkigfpwseirnisfndkkfvik pidkkapdfvfyaprlrinkrilalcmgnhelymrrrkpdt
Timeline for d2d2qa2: