SCOPe 2.08: Domain d2d2ob3: 2d2o B:121-502

Lineage for d2d2ob3 (2d2o B:121-502)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.8: (Trans)glycosidases [51445] (15 families)

5. Family c.1.8.1: Amylase, catalytic domain [51446] (26 proteins)
   members of the family may contain various insert subdomains
   in alpha-amylases and closer relatives this domain is usually followed by a common all-beta domain

6. Protein Maltogenic amylase, central domain [51465] (4 species)
   contains an additional N-terminal domain

7. Species Thermoactinomyces vulgaris, TVAII [TaxId:2026] [51467] (12 PDB entries)

8. Domain d2d2ob3: 2d2o B:121-502 [131181]
   Other proteins in same PDB: d2d2oa1, d2d2oa2, d2d2ob1, d2d2ob2
   automated match to d1jl8a3
   complexed with ca
   has additional subdomain(s) that are not in the common domain

Details for d2d2ob3

PDB Entry: 2d2o, 2.1 Å

PDB Description: structure of a complex of thermoactinomyces vulgaris r-47 alpha- amylase 2 with maltohexaose demonstrates the important role of aromatic residues at the reducing end of the substrate binding cleft

PDB Compounds: (B:) Neopullulanase 2

SCOPe Domain Sequences for d2d2ob3:

Sequence; same for both SEQRES and ATOM records:

>d2d2ob3 c.1.8.1 (B:121-502) Maltogenic amylase, central domain {Thermoactinomyces vulgaris, TVAII [TaxId: 2026]}
vfttpewakeaviyqifperfangdpsndppgteqwakdarprhdsfyggdlkgvidrlp
yleelgvtalyftpifaspshhkydtadylaidpqfgdlptfrrlvdeahrrgikiilda
vfnhagdqffafrdvlqkgeqsrykdwffiedfpvsktsrtnyetfavqvpampklrten
pevkeylfdvarfwmeqgidgwrlnvanevdhafwrefrrlvkslnpdalivgeiwhdas
gwlmgdqfdsvmnylfresvirffatgeihaerfdaeltrarmlypeqaaqglwnlldsh
dterfltscggneakfrlavlfqmtylgtpliyygdeigmagatdpdcrrpmiweekeqn
rglfefykelirlrhrlasltr

Timeline for d2d2ob3:

• d2d2ob3 first appeared in SCOP 1.73
  
• d2d2ob3 appears in SCOPe 2.07