Lineage for d2d2ob1 (2d2o B:1-120)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 651987Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 658571Superfamily b.1.18: E set domains [81296] (20 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 658673Family b.1.18.2: E-set domains of sugar-utilizing enzymes [81282] (19 proteins)
    domains of unknown function associated with different type of catalytic domains in a different sequential location
    subgroup of the larger IPT/TIG domain family
  6. 658832Protein Maltogenic amylase, N-terminal domain N [49221] (4 species)
    precedes the catalytic (beta/alpha)8-barrel domain
  7. 658847Species Thermoactinomyces vulgaris, TVAII [TaxId:2026] [49223] (16 PDB entries)
  8. 658851Domain d2d2ob1: 2d2o B:1-120 [131179]
    Other proteins in same PDB: d2d2oa2, d2d2oa3, d2d2ob2, d2d2ob3
    automatically matched to d1bvza1
    complexed with ca, glc; mutant

Details for d2d2ob1

PDB Entry: 2d2o (more details), 2.1 Å

PDB Description: Structure of a complex of Thermoactinomyces vulgaris R-47 alpha-amylase 2 with maltohexaose demonstrates the important role of aromatic residues at the reducing end of the substrate binding cleft
PDB Compounds: (B:) Neopullulanase 2

SCOP Domain Sequences for d2d2ob1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2d2ob1 b.1.18.2 (B:1-120) Maltogenic amylase, N-terminal domain N {Thermoactinomyces vulgaris, TVAII [TaxId: 2026]}
mlleaifheakgsyaypisetqlrvrlrakkgdvvrcevlyadryaspeeelahalagka
gsderfdyfeallecstkrvkyvflltgpqgeavyfgetgfsaerskagvfqyayihrse

SCOP Domain Coordinates for d2d2ob1:

Click to download the PDB-style file with coordinates for d2d2ob1.
(The format of our PDB-style files is described here.)

Timeline for d2d2ob1: