| Class b: All beta proteins [48724] (180 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.18: E set domains [81296] (27 families) ![]() "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies |
| Family b.1.18.2: E-set domains of sugar-utilizing enzymes [81282] (21 proteins) domains of unknown function associated with different type of catalytic domains in a different sequential location subgroup of the larger IPT/TIG domain family |
| Protein Maltogenic amylase, N-terminal domain N [49221] (4 species) precedes the catalytic (beta/alpha)8-barrel domain |
| Species Thermoactinomyces vulgaris, TVAII [TaxId:2026] [49223] (12 PDB entries) |
| Domain d2d2ob1: 2d2o B:1-120 [131179] Other proteins in same PDB: d2d2oa2, d2d2oa3, d2d2ob2, d2d2ob3 automated match to d1jl8a1 complexed with ca has additional insertions and/or extensions that are not grouped together |
PDB Entry: 2d2o (more details), 2.1 Å
SCOPe Domain Sequences for d2d2ob1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2d2ob1 b.1.18.2 (B:1-120) Maltogenic amylase, N-terminal domain N {Thermoactinomyces vulgaris, TVAII [TaxId: 2026]}
mlleaifheakgsyaypisetqlrvrlrakkgdvvrcevlyadryaspeeelahalagka
gsderfdyfeallecstkrvkyvflltgpqgeavyfgetgfsaerskagvfqyayihrse
Timeline for d2d2ob1: