Class b: All beta proteins [48724] (174 folds) |
Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily) folded sheet; greek-key |
Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families) this domain is C-terminal to the catalytic beta/alpha barrel domain |
Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (22 proteins) this domain follows the catalytic beta/alpha barrel domain |
Protein Maltogenic amylase [51031] (4 species) |
Species Thermoactinomyces vulgaris, TVAII [TaxId:2026] [51033] (16 PDB entries) |
Domain d2d2oa2: 2d2o A:503-585 [131177] Other proteins in same PDB: d2d2oa1, d2d2oa3, d2d2ob1, d2d2ob3 automated match to d1jl8a2 complexed with ca |
PDB Entry: 2d2o (more details), 2.1 Å
SCOPe Domain Sequences for d2d2oa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2d2oa2 b.71.1.1 (A:503-585) Maltogenic amylase {Thermoactinomyces vulgaris, TVAII [TaxId: 2026]} gnvrswhadkqanlyafvrtvqdqhvgvvlnnrgekqtvllqvpesggktwldcltgeev hgkqgqlkltlrpyqgmilwngr
Timeline for d2d2oa2: