Lineage for d2d2cs1 (2d2c S:2-36)

  1. Root: SCOPe 2.01
  2. 1058004Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)
  3. 1059389Fold f.23: Single transmembrane helix [81407] (38 superfamilies)
    not a true fold
  4. 1060095Superfamily f.23.25: PetM subunit of the cytochrome b6f complex [103441] (1 family) (S)
  5. 1060096Family f.23.25.1: PetM subunit of the cytochrome b6f complex [103442] (1 protein)
  6. 1060097Protein PetM subunit of the cytochrome b6f complex [103443] (2 species)
  7. 1060100Species Mastigocladus laminosus [TaxId:83541] [103444] (5 PDB entries)
  8. 1060107Domain d2d2cs1: 2d2c S:2-36 [131171]
    Other proteins in same PDB: d2d2ca1, d2d2cb1, d2d2cd1, d2d2cd2, d2d2ce1, d2d2cg1, d2d2ch1, d2d2cn1, d2d2co1, d2d2cq1, d2d2cq2, d2d2cr1, d2d2ct1, d2d2cu1
    automatically matched to d1vf5s_
    complexed with bcr, bnt, cla, fes, hec, hem, opc

Details for d2d2cs1

PDB Entry: 2d2c (more details), 3.8 Å

PDB Description: Crystal Structure Of Cytochrome B6F Complex with DBMIB From M. Laminosus
PDB Compounds: (S:) Cytochrome b6-f complex subunit VII

SCOPe Domain Sequences for d2d2cs1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2d2cs1 f.23.25.1 (S:2-36) PetM subunit of the cytochrome b6f complex {Mastigocladus laminosus [TaxId: 83541]}
mteemlyaallsfglifvgwglgvlllkiqgaeke

SCOPe Domain Coordinates for d2d2cs1:

Click to download the PDB-style file with coordinates for d2d2cs1.
(The format of our PDB-style files is described here.)

Timeline for d2d2cs1: