SCOPe 2.01: Domain d2d2cn1: 2d2c N:13-214

Lineage for d2d2cn1 (2d2c N:13-214)

1. Root: SCOPe 2.01

2. Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)

3. Fold f.21: Heme-binding four-helical bundle [81344] (3 superfamilies)
   core: four transmembrane helices, up-and-down bundle, binds one or two heme groups in between the helices

4. Superfamily f.21.1: Transmembrane di-heme cytochromes [81342] (2 families)
   Three of the four heme-ligands are conserved between the two families; both heme groups bind similarly but not identically

5. Family f.21.1.2: Cytochrome b of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81642] (2 proteins)
   a part (domain) of a larger mitochondrial cytochrome b subunit, separate subunit in plants and cyanobacteria

6. Protein Cytochrome b6 subunit of the cytochrome b6f complex [103498] (2 species)

7. Species Mastigocladus laminosus [TaxId:83541] [103499] (5 PDB entries)

8. Domain d2d2cn1: 2d2c N:13-214 [131167]
   Other proteins in same PDB: d2d2cb1, d2d2cd1, d2d2cd2, d2d2ce1, d2d2cf1, d2d2cg1, d2d2ch1, d2d2co1, d2d2cq1, d2d2cq2, d2d2cr1, d2d2cs1, d2d2ct1, d2d2cu1
   automatically matched to d1vf5a_
   complexed with bcr, bnt, cla, fes, hec, hem, opc

Details for d2d2cn1

PDB Entry: 2d2c, 3.8 Å

PDB Description: Crystal Structure Of Cytochrome B6F Complex with DBMIB From M. Laminosus

PDB Compounds: (N:) Cytochrome b6

SCOPe Domain Sequences for d2d2cn1:

Sequence; same for both SEQRES and ATOM records:

>d2d2cn1 f.21.1.2 (N:13-214) Cytochrome b6 subunit of the cytochrome b6f complex {Mastigocladus laminosus [TaxId: 83541]}
eiqaladdvtskyvpphvnifyclggitltcfliqfatgfamtfyykptvteayasvqyi
mnevsfgwlirsihrwsasmmvlmmilhvfrvyltggfkkpreltwisgvilavitvsfg
vtgyslpwdqvgywavkivsgvpeaipvvgvlisdllrggssvgqatltryysahtfvlp
wliavfmllhflmirkqgisgp

Timeline for d2d2cn1:

• d2d2cn1 first appeared in SCOP 1.73
  
• d2d2cn1 appears in SCOP 1.75
  
• d2d2cn1 appears in SCOPe 2.02
  
• d2d2cn1 appears in the current release, SCOPe 2.08