| Class f: Membrane and cell surface proteins and peptides [56835] (57 folds) |
| Fold f.21: Heme-binding four-helical bundle [81344] (3 superfamilies) core: four transmembrane helices, up-and-down bundle, binds one or two heme groups in between the helices |
Superfamily f.21.1: Transmembrane di-heme cytochromes [81342] (2 families) ![]() Three of the four heme-ligands are conserved between the two families; both heme groups bind similarly but not identically |
| Family f.21.1.2: Cytochrome b of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81642] (2 proteins) a part (domain) of a larger mitochondrial cytochrome b subunit, separate subunit in plants and cyanobacteria |
| Protein Cytochrome b6 subunit of the cytochrome b6f complex [103498] (2 species) |
| Species Mastigocladus laminosus [TaxId:83541] [103499] (5 PDB entries) |
| Domain d2d2cn1: 2d2c N:13-214 [131167] Other proteins in same PDB: d2d2cb1, d2d2cd1, d2d2cd2, d2d2ce1, d2d2cf1, d2d2cg1, d2d2ch1, d2d2co1, d2d2cq1, d2d2cq2, d2d2cr1, d2d2cs1, d2d2ct1, d2d2cu1 automatically matched to d1vf5a_ complexed with bcr, bnt, cla, fes, hec, hem, opc |
PDB Entry: 2d2c (more details), 3.8 Å
SCOPe Domain Sequences for d2d2cn1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2d2cn1 f.21.1.2 (N:13-214) Cytochrome b6 subunit of the cytochrome b6f complex {Mastigocladus laminosus [TaxId: 83541]}
eiqaladdvtskyvpphvnifyclggitltcfliqfatgfamtfyykptvteayasvqyi
mnevsfgwlirsihrwsasmmvlmmilhvfrvyltggfkkpreltwisgvilavitvsfg
vtgyslpwdqvgywavkivsgvpeaipvvgvlisdllrggssvgqatltryysahtfvlp
wliavfmllhflmirkqgisgp
Timeline for d2d2cn1: