Lineage for d2d2cf1 (2d2c F:2-36)

  1. Root: SCOPe 2.02
  2. 1236525Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)
  3. 1237971Fold f.23: Single transmembrane helix [81407] (38 superfamilies)
    not a true fold
  4. 1238700Superfamily f.23.25: PetM subunit of the cytochrome b6f complex [103441] (1 family) (S)
  5. 1238701Family f.23.25.1: PetM subunit of the cytochrome b6f complex [103442] (1 protein)
  6. 1238702Protein PetM subunit of the cytochrome b6f complex [103443] (2 species)
  7. 1238705Species Mastigocladus laminosus [TaxId:83541] [103444] (6 PDB entries)
  8. 1238712Domain d2d2cf1: 2d2c F:2-36 [131165]
    Other proteins in same PDB: d2d2ca1, d2d2cb1, d2d2cd1, d2d2cd2, d2d2ce1, d2d2cg1, d2d2ch1, d2d2cn1, d2d2co1, d2d2cq1, d2d2cq2, d2d2cr1, d2d2ct1, d2d2cu1
    automatically matched to d1vf5s_
    complexed with bcr, bnt, cla, fes, hec, hem, opc

Details for d2d2cf1

PDB Entry: 2d2c (more details), 3.8 Å

PDB Description: Crystal Structure Of Cytochrome B6F Complex with DBMIB From M. Laminosus
PDB Compounds: (F:) Cytochrome b6-f complex subunit VII

SCOPe Domain Sequences for d2d2cf1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2d2cf1 f.23.25.1 (F:2-36) PetM subunit of the cytochrome b6f complex {Mastigocladus laminosus [TaxId: 83541]}
mteemlyaallsfglifvgwglgvlllkiqgaeke

SCOPe Domain Coordinates for d2d2cf1:

Click to download the PDB-style file with coordinates for d2d2cf1.
(The format of our PDB-style files is described here.)

Timeline for d2d2cf1: