Class f: Membrane and cell surface proteins and peptides [56835] (50 folds) |
Fold f.23: Single transmembrane helix [81407] (30 superfamilies) not a true fold |
Superfamily f.23.25: PetM subunit of the cytochrome b6f complex [103441] (1 family) |
Family f.23.25.1: PetM subunit of the cytochrome b6f complex [103442] (1 protein) |
Protein PetM subunit of the cytochrome b6f complex [103443] (2 species) |
Species Mastigocladus laminosus [TaxId:83541] [103444] (5 PDB entries) |
Domain d2d2cf1: 2d2c F:2-36 [131165] Other proteins in same PDB: d2d2ca1, d2d2cb1, d2d2cd1, d2d2cd2, d2d2cg1, d2d2cn1, d2d2co1, d2d2cq1, d2d2cq2, d2d2ct1 automatically matched to d1vf5s_ complexed with bcr, bnt, cla, fes, hec, hem, opc |
PDB Entry: 2d2c (more details), 3.8 Å
SCOP Domain Sequences for d2d2cf1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2d2cf1 f.23.25.1 (F:2-36) PetM subunit of the cytochrome b6f complex {Mastigocladus laminosus [TaxId: 83541]} mteemlyaallsfglifvgwglgvlllkiqgaeke
Timeline for d2d2cf1: