SCOP 1.73: Domain d2d2cd2: 2d2c D:12-45

Lineage for d2d2cd2 (2d2c D:12-45)

1. Root: SCOP 1.73

2. Class f: Membrane and cell surface proteins and peptides [56835] (50 folds)

3. Fold f.23: Single transmembrane helix [81407] (30 superfamilies)
   not a true fold

4. Superfamily f.23.12: ISP transmembrane anchor [81502] (1 family)

5. Family f.23.12.1: ISP transmembrane anchor [81501] (2 proteins)

6. Protein ISP subunit from the cytochrome b6f complex, transmembrane anchor [103428] (2 species)

7. Species Mastigocladus laminosus [TaxId:83541] [103429] (5 PDB entries)

8. Domain d2d2cd2: 2d2c D:12-45 [131164]
   Other proteins in same PDB: d2d2ca1, d2d2cb1, d2d2cd1, d2d2cf1, d2d2cg1, d2d2cn1, d2d2co1, d2d2cq1, d2d2cs1, d2d2ct1
   automatically matched to d1vf5d2
   complexed with bcr, bnt, cla, fes, hec, hem, opc

Details for d2d2cd2

PDB Entry: 2d2c, 3.8 Å

PDB Description: Crystal Structure Of Cytochrome B6F Complex with DBMIB From M. Laminosus

PDB Compounds: (D:) Cytochrome b6-f complex iron-sulfur subunit

SCOP Domain Sequences for d2d2cd2:

Sequence; same for both SEQRES and ATOM records:

>d2d2cd2 f.23.12.1 (D:12-45) ISP subunit from the cytochrome b6f complex, transmembrane anchor {Mastigocladus laminosus [TaxId: 83541]}
dmgrrqfmnllafgtvtgvalgalyplvkyfipp

Timeline for d2d2cd2:

• d2d2cd2 is new in SCOP 1.73
  
• d2d2cd2 appears in SCOP 1.75
  
• d2d2cd2 appears in the current release, SCOPe 2.08