| Class f: Membrane and cell surface proteins and peptides [56835] (57 folds) |
| Fold f.32: a domain/subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81649] (1 superfamily) core: three transmembrane helices, up-and-down bundle |
Superfamily f.32.1: a domain/subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81648] (1 family) ![]() |
| Family f.32.1.1: a domain/subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81647] (2 proteins) a part (domain) of mitochondrial cytochrome b subunit, separate subunit in plants and cyanobacteria |
| Protein Subunit IV of the cytochrome b6f complex [103495] (2 species) |
| Species Mastigocladus laminosus [TaxId:83541] [103496] (5 PDB entries) |
| Domain d2d2cb1: 2d2c B:18-154 [131162] Other proteins in same PDB: d2d2ca1, d2d2cd1, d2d2cd2, d2d2ce1, d2d2cf1, d2d2cg1, d2d2ch1, d2d2cn1, d2d2cq1, d2d2cq2, d2d2cr1, d2d2cs1, d2d2ct1, d2d2cu1 automatically matched to d1vf5b_ complexed with bcr, bnt, cla, fes, hec, hem, opc |
PDB Entry: 2d2c (more details), 3.8 Å
SCOPe Domain Sequences for d2d2cb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2d2cb1 f.32.1.1 (B:18-154) Subunit IV of the cytochrome b6f complex {Mastigocladus laminosus [TaxId: 83541]}
lakgmghnyygepawpndllyvfpvvimgtfacivalsvldpamvgepanpfatpleilp
ewylypvfqilrslpnkllgvllmasvplglilvpfienvnkfqnpfrrpvattiflfgt
lvtiwlgigaalpldkt
Timeline for d2d2cb1: