Lineage for d2d2ca1 (2d2c A:13-214)

  1. Root: SCOP 1.73
  2. 744527Class f: Membrane and cell surface proteins and peptides [56835] (50 folds)
  3. 745424Fold f.21: Heme-binding four-helical bundle [81344] (3 superfamilies)
    core: four transmembrane helices, up-and-down bundle, binds one or two heme groups in between the helices
  4. 745425Superfamily f.21.1: Transmembrane di-heme cytochromes [81342] (2 families) (S)
    Three of the four heme-ligands are conserved between the two families; both heme groups bind similarly but not identically
  5. 745431Family f.21.1.2: Cytochrome b of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81642] (2 proteins)
    a part (domain) of a larger mitochondrial cytochrome b subunit, separate subunit in plants and cyanobacteria
  6. 745432Protein Cytochrome b6 subunit of the cytochrome b6f complex [103498] (2 species)
  7. 745435Species Mastigocladus laminosus [TaxId:83541] [103499] (5 PDB entries)
  8. 745441Domain d2d2ca1: 2d2c A:13-214 [131161]
    Other proteins in same PDB: d2d2cb1, d2d2cd1, d2d2cd2, d2d2cf1, d2d2cg1, d2d2co1, d2d2cq1, d2d2cq2, d2d2cs1, d2d2ct1
    automatically matched to d1vf5a_
    complexed with bcr, bnt, cla, fes, hec, hem, opc

Details for d2d2ca1

PDB Entry: 2d2c (more details), 3.8 Å

PDB Description: Crystal Structure Of Cytochrome B6F Complex with DBMIB From M. Laminosus
PDB Compounds: (A:) Cytochrome b6

SCOP Domain Sequences for d2d2ca1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2d2ca1 f.21.1.2 (A:13-214) Cytochrome b6 subunit of the cytochrome b6f complex {Mastigocladus laminosus [TaxId: 83541]}
eiqaladdvtskyvpphvnifyclggitltcfliqfatgfamtfyykptvteayasvqyi
mnevsfgwlirsihrwsasmmvlmmilhvfrvyltggfkkpreltwisgvilavitvsfg
vtgyslpwdqvgywavkivsgvpeaipvvgvlisdllrggssvgqatltryysahtfvlp
wliavfmllhflmirkqgisgp

SCOP Domain Coordinates for d2d2ca1:

Click to download the PDB-style file with coordinates for d2d2ca1.
(The format of our PDB-style files is described here.)

Timeline for d2d2ca1: