Class e: Multi-domain proteins (alpha and beta) [56572] (53 folds) |
Fold e.6: Acyl-CoA dehydrogenase NM domain-like [56644] (1 superfamily) 2 domains: (1) all-alpha: 5 helices; (2) contains an open beta-sheet barrel: n*=5, S*=8; complex topology |
Superfamily e.6.1: Acyl-CoA dehydrogenase NM domain-like [56645] (2 families) flavoprotein: binds FAD; constituent families differ in the numbers of C-terminal domains (four-helical bundles) |
Family e.6.1.1: Medium chain acyl-CoA dehydrogenase, NM (N-terminal and middle) domains [56646] (9 proteins) |
Protein Acyl-CoA dehydrogenase [144024] (1 species) |
Species Thermus thermophilus [TaxId:274] [144025] (3 PDB entries) |
Domain d2d29b2: 2d29 B:2-234 [131160] Other proteins in same PDB: d2d29a1, d2d29b1 automatically matched to 1WS9 A:2-234 complexed with fad |
PDB Entry: 2d29 (more details), 1.65 Å
SCOP Domain Sequences for d2d29b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2d29b2 e.6.1.1 (B:2-234) Acyl-CoA dehydrogenase {Thermus thermophilus [TaxId: 274]} glwfeegaeerqvlgpfreflkaevapgaaerdrtgafpwdlvrklaefgvfgalvpeay ggaglstrlfarmveaiayydgalaltvashnslatghillagseaqkeaflpklasgea lgawgltepgsgsdaaalktkaekveggwrlngtkqfitqgsvagvyvvmartdpppspe rkhqgisafaffrperglkvgrkeeklgltasdtaqliledlfvpeeallger
Timeline for d2d29b2: