SCOPe 2.04: Domain d2d1hb_: 2d1h B:

Lineage for d2d1hb_ (2d1h B:)

1. Root: SCOPe 2.04

2. Class a: All alpha proteins [46456] (285 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families)
   contains a small beta-sheet (wing)

5. Family a.4.5.50: TrmB-like [109680] (2 proteins)
   The N- and C-terminal helical extensions to the common fold form the dimer interface, distinct from other known families

6. Protein Hypothetical transcriptional regulator ST1889 [140273] (1 species)

7. Species Sulfolobus tokodaii [TaxId:111955] [140274] (1 PDB entry)
   Uniprot Q96ZE4 1-109

8. Domain d2d1hb_: 2d1h B: [131126]
   automated match to d2d1ha1

Details for d2d1hb_

PDB Entry: 2d1h, 2.05 Å

PDB Description: Crystal structure of ST1889 protein from thermoacidophilic archaeon Sulfolobus tokodaii

PDB Compounds: (B:) 109aa long hypothetical transcriptional regulator

SCOPe Domain Sequences for d2d1hb_:

Sequence, based on SEQRES records:

>d2d1hb_ a.4.5.50 (B:) Hypothetical transcriptional regulator ST1889 {Sulfolobus tokodaii [TaxId: 111955]}
mmkekleskkdeirccykitdtdvavllkmveiekpitseeladifklskttvenslkkl
ielglvvrtktegkkigrpkyyysissnilekirndllncakrmelaat

Sequence, based on observed residues (ATOM records):

>d2d1hb_ a.4.5.50 (B:) Hypothetical transcriptional regulator ST1889 {Sulfolobus tokodaii [TaxId: 111955]}
mkleskkdeirccykitdtdvavllkmveiekpitseeladifklskttvenslkkliel
glvvrtktpkyyysissnilekirndllncakrmelaat

Timeline for d2d1hb_:

• d2d1hb_ first appeared in SCOP 1.73, called d2d1hb1
  
• d2d1hb_ appears in SCOPe 2.03
  
• d2d1hb_ appears in SCOPe 2.05
  
• d2d1hb_ appears in the current release, SCOPe 2.08