Class a: All alpha proteins [46456] (284 folds) |
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (84 families) contains a small beta-sheet (wing) |
Family a.4.5.50: TrmB-like [109680] (2 proteins) The N- and C-terminal helical extensions to the common fold form the dimer interface, distinct from other known families |
Protein Hypothetical transcriptional regulator ST1889 [140273] (1 species) |
Species Sulfolobus tokodaii [TaxId:111955] [140274] (1 PDB entry) Uniprot Q96ZE4 1-109 |
Domain d2d1hb1: 2d1h B:1-109 [131126] automatically matched to 2D1H A:1-109 |
PDB Entry: 2d1h (more details), 2.05 Å
SCOP Domain Sequences for d2d1hb1:
Sequence, based on SEQRES records: (download)
>d2d1hb1 a.4.5.50 (B:1-109) Hypothetical transcriptional regulator ST1889 {Sulfolobus tokodaii [TaxId: 111955]} mmkekleskkdeirccykitdtdvavllkmveiekpitseeladifklskttvenslkkl ielglvvrtktegkkigrpkyyysissnilekirndllncakrmelaat
>d2d1hb1 a.4.5.50 (B:1-109) Hypothetical transcriptional regulator ST1889 {Sulfolobus tokodaii [TaxId: 111955]} mkleskkdeirccykitdtdvavllkmveiekpitseeladifklskttvenslkkliel glvvrtktpkyyysissnilekirndllncakrmelaat
Timeline for d2d1hb1: