SCOP 1.75: Domain d2d1hb1: 2d1h B:1-109

Lineage for d2d1hb1 (2d1h B:1-109)

1. Root: SCOP 1.75

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (84 families)
   contains a small beta-sheet (wing)

5. Family a.4.5.50: TrmB-like [109680] (2 proteins)
   The N- and C-terminal helical extensions to the common fold form the dimer interface, distinct from other known families

6. Protein Hypothetical transcriptional regulator ST1889 [140273] (1 species)

7. Species Sulfolobus tokodaii [TaxId:111955] [140274] (1 PDB entry)
   Uniprot Q96ZE4 1-109

8. Domain d2d1hb1: 2d1h B:1-109 [131126]
   automatically matched to 2D1H A:1-109

Details for d2d1hb1

PDB Entry: 2d1h, 2.05 Å

PDB Description: Crystal structure of ST1889 protein from thermoacidophilic archaeon Sulfolobus tokodaii

PDB Compounds: (B:) 109aa long hypothetical transcriptional regulator

SCOP Domain Sequences for d2d1hb1:

Sequence, based on SEQRES records:

>d2d1hb1 a.4.5.50 (B:1-109) Hypothetical transcriptional regulator ST1889 {Sulfolobus tokodaii [TaxId: 111955]}
mmkekleskkdeirccykitdtdvavllkmveiekpitseeladifklskttvenslkkl
ielglvvrtktegkkigrpkyyysissnilekirndllncakrmelaat

Sequence, based on observed residues (ATOM records):

>d2d1hb1 a.4.5.50 (B:1-109) Hypothetical transcriptional regulator ST1889 {Sulfolobus tokodaii [TaxId: 111955]}
mkleskkdeirccykitdtdvavllkmveiekpitseeladifklskttvenslkkliel
glvvrtktpkyyysissnilekirndllncakrmelaat

Timeline for d2d1hb1:

• d2d1hb1 first appeared in SCOP 1.73
  
• d2d1hb1 is called d2d1hb_ in SCOPe 2.01
  
• d2d1hb1 appears in the current release, SCOPe 2.08, called d2d1hb_