Lineage for d2d11d1 (2d11 D:88-198)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 764491Fold a.11: Acyl-CoA binding protein-like [47026] (2 superfamilies)
    core: 3 helices; bundle, closed, left-handed twist; up-and-down
  4. 764506Superfamily a.11.2: Second domain of FERM [47031] (1 family) (S)
  5. 764507Family a.11.2.1: Second domain of FERM [47032] (8 proteins)
  6. 764536Protein Radixin [47035] (1 species)
  7. 764537Species Mouse (Mus musculus) [TaxId:10090] [47036] (10 PDB entries)
  8. 764548Domain d2d11d1: 2d11 D:88-198 [131118]
    Other proteins in same PDB: d2d11a2, d2d11a3, d2d11b2, d2d11b3, d2d11c2, d2d11c3, d2d11d2, d2d11d3
    automatically matched to d1gc6a1

Details for d2d11d1

PDB Entry: 2d11 (more details), 2.81 Å

PDB Description: Crystal structure of the Radixin FERM domain complexed with the NHERF-2 C-terminal tail peptide
PDB Compounds: (D:) Radixin

SCOP Domain Sequences for d2d11d1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2d11d1 a.11.2.1 (D:88-198) Radixin {Mouse (Mus musculus) [TaxId: 10090]}
dvseeliqeitqrlfflqvkeailndeiycppetavllasyavqakygdynkeihkpgyl
andrllpqrvleqhkltkeqweeriqnwheehrgmlredsmmeylkiaqdl

SCOP Domain Coordinates for d2d11d1:

Click to download the PDB-style file with coordinates for d2d11d1.
(The format of our PDB-style files is described here.)

Timeline for d2d11d1: