Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
Superfamily d.15.1: Ubiquitin-like [54236] (11 families) |
Family d.15.1.4: First domain of FERM [54256] (6 proteins) |
Protein Radixin [54259] (1 species) |
Species Mouse (Mus musculus) [TaxId:10090] [54260] (9 PDB entries) |
Domain d2d11b3: 2d11 B:3-87 [131114] Other proteins in same PDB: d2d11a1, d2d11a2, d2d11b1, d2d11b2, d2d11c1, d2d11c2, d2d11d1, d2d11d2 automatically matched to d1gc6a3 |
PDB Entry: 2d11 (more details), 2.81 Å
SCOPe Domain Sequences for d2d11b3:
Sequence; same for both SEQRES and ATOM records: (download)
>d2d11b3 d.15.1.4 (B:3-87) Radixin {Mouse (Mus musculus) [TaxId: 10090]} kpinvrvttmdaelefaiqpnttgkqlfdqvvktvglrevwffglqyvdskgystwlkln kkvtqqdvkkenplqfkfrakffpe
Timeline for d2d11b3: