Lineage for d2d11b3 (2d11 B:3-87)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2177211Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2177212Superfamily d.15.1: Ubiquitin-like [54236] (11 families) (S)
  5. 2178480Family d.15.1.4: First domain of FERM [54256] (6 proteins)
  6. 2178510Protein Radixin [54259] (1 species)
  7. 2178511Species Mouse (Mus musculus) [TaxId:10090] [54260] (9 PDB entries)
  8. 2178520Domain d2d11b3: 2d11 B:3-87 [131114]
    Other proteins in same PDB: d2d11a1, d2d11a2, d2d11b1, d2d11b2, d2d11c1, d2d11c2, d2d11d1, d2d11d2
    automatically matched to d1gc6a3

Details for d2d11b3

PDB Entry: 2d11 (more details), 2.81 Å

PDB Description: Crystal structure of the Radixin FERM domain complexed with the NHERF-2 C-terminal tail peptide
PDB Compounds: (B:) Radixin

SCOPe Domain Sequences for d2d11b3:

Sequence; same for both SEQRES and ATOM records: (download)

>d2d11b3 d.15.1.4 (B:3-87) Radixin {Mouse (Mus musculus) [TaxId: 10090]}
kpinvrvttmdaelefaiqpnttgkqlfdqvvktvglrevwffglqyvdskgystwlkln
kkvtqqdvkkenplqfkfrakffpe

SCOPe Domain Coordinates for d2d11b3:

Click to download the PDB-style file with coordinates for d2d11b3.
(The format of our PDB-style files is described here.)

Timeline for d2d11b3: