Class b: All beta proteins [48724] (177 folds) |
Fold b.55: PH domain-like barrel [50728] (2 superfamilies) barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix |
Superfamily b.55.1: PH domain-like [50729] (14 families) |
Family b.55.1.5: Third domain of FERM [50776] (8 proteins) |
Protein Radixin [50779] (1 species) |
Species Mouse (Mus musculus) [TaxId:10090] [50780] (9 PDB entries) |
Domain d2d10c2: 2d10 C:199-297 [131104] Other proteins in same PDB: d2d10a1, d2d10a3, d2d10b1, d2d10b3, d2d10c1, d2d10c3, d2d10d1, d2d10d3 automatically matched to d1gc6a2 |
PDB Entry: 2d10 (more details), 2.5 Å
SCOPe Domain Sequences for d2d10c2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2d10c2 b.55.1.5 (C:199-297) Radixin {Mouse (Mus musculus) [TaxId: 10090]} emygvnyfeiknkkgtelwlgvdalglniyehddkltpkigfpwseirnisfndkkfvik pidkkapdfvfyaprlrinkrilalcmgnhelymrrrkp
Timeline for d2d10c2: