SCOPe 2.05: Domain d2d0qa_: 2d0q A:

Lineage for d2d0qa_ (2d0q A:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.149: Nitrile hydratase alpha chain [56208] (1 superfamily)
   4 layers a/b/b/a; inside is a sandwich of two 2-stranded beta-sheets

4. Superfamily d.149.1: Nitrile hydratase alpha chain [56209] (2 families)
   duplication: contains two structural repeats

5. Family d.149.1.1: Nitrile hydratase alpha chain [56210] (3 proteins)
   automatically mapped to Pfam PF02979

6. Protein automated matches [190256] (6 species)
   not a true protein

7. Species Rhodococcus erythropolis [TaxId:1833] [187042] (20 PDB entries)

8. Domain d2d0qa_: 2d0q A: [131091]
   Other proteins in same PDB: d2d0qb_
   automated match to d2ahja_
   complexed with cyi, fe, mg

Details for d2d0qa_

PDB Entry: 2d0q, 1.65 Å

PDB Description: Complex of Fe-type NHase with Cyclohexyl isocyanide, photo-activated for 1hr at 277K

PDB Compounds: (A:) Nitrile hydratase subunit alpha

SCOPe Domain Sequences for d2d0qa_:

Sequence; same for both SEQRES and ATOM records:

>d2d0qa_ d.149.1.1 (A:) automated matches {Rhodococcus erythropolis [TaxId: 1833]}
aqapvsdrawalfraldgkglvpdgyvegwkktfeedfsprrgaelvarawtdpefrqll
ltdgtaavaqygylgpqgeyivavedtptlknvivcslcsctawpilglpptwyksfeyr
arvvreprkvlsemgteiasdieirvydttaetrymvlpqrpagtegwsqeqlqeivtkd
cligvaipqvpt

Timeline for d2d0qa_:

• d2d0qa_ first appeared in SCOP 1.73, called d2d0qa1
  
• d2d0qa_ appears in SCOPe 2.04
  
• d2d0qa_ appears in SCOPe 2.06
  
• d2d0qa_ appears in the current release, SCOPe 2.08