Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.8: The 'swivelling' beta/beta/alpha domain [52008] (10 superfamilies) 3 layers: b/b/a; the central sheet is parallel, and the other one is antiparallel; there are some variations in topology this domain is thought to be mobile in most multi-domain proteins known to contain it |
Superfamily c.8.6: Swiveling domain of dehydratase reactivase alpha subunit [82317] (1 family) |
Family c.8.6.1: Swiveling domain of dehydratase reactivase alpha subunit [82318] (2 proteins) |
Protein Diol dehydratase-reactivating factor large subunit DdrA [141982] (1 species) |
Species Klebsiella oxytoca [TaxId:571] [141983] (2 PDB entries) Uniprot O68195 93-254 |
Domain d2d0oc1: 2d0o C:93-254 [131079] Other proteins in same PDB: d2d0oa2, d2d0oa3, d2d0ob1, d2d0oc2, d2d0oc3, d2d0od_ automated match to d2d0oa1 complexed with adp, mg, so4 |
PDB Entry: 2d0o (more details), 2 Å
SCOPe Domain Sequences for d2d0oc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2d0oc1 c.8.6.1 (C:93-254) Diol dehydratase-reactivating factor large subunit DdrA {Klebsiella oxytoca [TaxId: 571]} itestmighnpktpggaglgtgititpqelltrpadapyilvvssafdfadiasvinasl ragyqitgvilqrddgvlvsnrlekplpivdevlyidriplgmlaaievavpgkvietls npygiatvfnlspeetknivpmaralignrsavvvktpsgdv
Timeline for d2d0oc1: