Lineage for d2d0ha2 (2d0h A:555-637)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2810331Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
    folded sheet; greek-key
  4. 2810332Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families) (S)
    this domain is C-terminal to the catalytic beta/alpha barrel domain
  5. 2810333Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (22 proteins)
    this domain follows the catalytic beta/alpha barrel domain
  6. 2810619Protein Maltogenic amylase [51031] (4 species)
  7. 2810623Species Thermoactinomyces vulgaris, TVAI [TaxId:2026] [75017] (8 PDB entries)
  8. 2810628Domain d2d0ha2: 2d0h A:555-637 [131071]
    Other proteins in same PDB: d2d0ha1, d2d0ha3
    automated match to d1uh4a2
    complexed with ca, mpd; mutant

Details for d2d0ha2

PDB Entry: 2d0h (more details), 2.1 Å

PDB Description: crystal structure of thermoactinomyces vulgaris r-47 alpha-amylase 1 (tvai) mutant d356n/e396q complexed with p2, a pullulan model oligosaccharide
PDB Compounds: (A:) alpha-amylase I

SCOPe Domain Sequences for d2d0ha2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2d0ha2 b.71.1.1 (A:555-637) Maltogenic amylase {Thermoactinomyces vulgaris, TVAI [TaxId: 2026]}
sfmtlitddtnkiysygrfdnvnriavvlnndsvshtvnvpvwqlsmpngstvtdkitgh
sytvqngmvtvavdghygavlaq

SCOPe Domain Coordinates for d2d0ha2:

Click to download the PDB-style file with coordinates for d2d0ha2.
(The format of our PDB-style files is described here.)

Timeline for d2d0ha2: