Lineage for d2d0fa3 (2d0f A:123-554)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2829818Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2829819Family c.1.8.1: Amylase, catalytic domain [51446] (26 proteins)
    members of the family may contain various insert subdomains
    in alpha-amylases and closer relatives this domain is usually followed by a common all-beta domain
  6. 2830345Protein automated matches [190099] (31 species)
    not a true protein
  7. 2830532Species Thermoactinomyces vulgaris [TaxId:2026] [254920] (8 PDB entries)
  8. 2830538Domain d2d0fa3: 2d0f A:123-554 [131066]
    Other proteins in same PDB: d2d0fa1, d2d0fa2
    automated match to d1ji1a3
    complexed with ca, mpd; mutant

Details for d2d0fa3

PDB Entry: 2d0f (more details), 2.08 Å

PDB Description: crystal structure of thermoactinomyces vulgaris r-47 alpha-amylase 1 (tvai) mutant d356n complexed with p2, a pullulan model oligosaccharide
PDB Compounds: (A:) alpha-amylase I

SCOPe Domain Sequences for d2d0fa3:

Sequence; same for both SEQRES and ATOM records: (download)

>d2d0fa3 c.1.8.1 (A:123-554) automated matches {Thermoactinomyces vulgaris [TaxId: 2026]}
nfktpdwlkngvmyqifpdrfyngdssndvqtgsytyngtptekkawgssvyadpgydns
lvffggdlagidqklgyikktlganilylnpifkaptnhkydtqdymavdpafgdnstlq
tlindihstangpkgylildgvfnhtgdshpwfdkynnfssqgayesqsspwynyytfyt
wpdsyasflgfnslpklnygnsgsavrgviynnsnsvaktylnppysvdgwrlnaaqyvd
angnngsdvtnhqiwsefrnavkgvnsnaaiigeywgnanpwtaqgnqwdaatnfdgftq
pvsewitgkdyqnnsasisttqfdswlrgtranyptnvqqsmmnflsnhditrfatrsgg
dlwktylalifqmtyvgtptiyygdeygmqggadpdnrrsfdwsqatpsnsavaltqkli
tirnqypalrtg

SCOPe Domain Coordinates for d2d0fa3:

Click to download the PDB-style file with coordinates for d2d0fa3.
(The format of our PDB-style files is described here.)

Timeline for d2d0fa3: