Lineage for d2d0fa2 (2d0f A:555-637)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1555652Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
    folded sheet; greek-key
  4. 1555653Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families) (S)
    this domain is C-terminal to the catalytic beta/alpha barrel domain
  5. 1556225Family b.71.1.0: automated matches [227134] (1 protein)
    not a true family
  6. 1556226Protein automated matches [226835] (27 species)
    not a true protein
  7. Species Thermoactinomyces vulgaris [TaxId:2026] [254921] (6 PDB entries)
  8. 1556342Domain d2d0fa2: 2d0f A:555-637 [131065]
    Other proteins in same PDB: d2d0fa1, d2d0fa3
    automated match to d1ji1a2
    complexed with ca, mpd; mutant

Details for d2d0fa2

PDB Entry: 2d0f (more details), 2.08 Å

PDB Description: crystal structure of thermoactinomyces vulgaris r-47 alpha-amylase 1 (tvai) mutant d356n complexed with p2, a pullulan model oligosaccharide
PDB Compounds: (A:) alpha-amylase I

SCOPe Domain Sequences for d2d0fa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2d0fa2 b.71.1.0 (A:555-637) automated matches {Thermoactinomyces vulgaris [TaxId: 2026]}
sfmtlitddtnkiysygrfdnvnriavvlnndsvshtvnvpvwqlsmpngstvtdkitgh
sytvqngmvtvavdghygavlaq

SCOPe Domain Coordinates for d2d0fa2:

Click to download the PDB-style file with coordinates for d2d0fa2.
(The format of our PDB-style files is described here.)

Timeline for d2d0fa2: