![]() | Class b: All beta proteins [48724] (177 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.18: E set domains [81296] (24 families) ![]() "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies |
![]() | Family b.1.18.0: automated matches [191341] (1 protein) not a true family |
![]() | Protein automated matches [190226] (55 species) not a true protein |
![]() | Species Thermoactinomyces vulgaris [TaxId:2026] [254919] (6 PDB entries) |
![]() | Domain d2d0fa1: 2d0f A:1-122 [131064] Other proteins in same PDB: d2d0fa2, d2d0fa3 automated match to d1ji1a1 complexed with ca, mpd; mutant |
PDB Entry: 2d0f (more details), 2.08 Å
SCOPe Domain Sequences for d2d0fa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2d0fa1 b.1.18.0 (A:1-122) automated matches {Thermoactinomyces vulgaris [TaxId: 2026]} aandnnvewnglfhdqgplfdnapeptstqsvtlklrtfkgditsanikywdtadnafhw vpmvwdsndptgtfdywkgtipaspsikyyrfqindgtstawyngngpsstepnaddfyi ip
Timeline for d2d0fa1: