SCOPe 2.06: Domain d2d07b_: 2d07 B:

Lineage for d2d07b_ (2d07 B:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.1: Ubiquitin-like [54236] (11 families)

5. Family d.15.1.1: Ubiquitin-related [54237] (39 proteins)
   Pfam PF00240

6. Protein automated matches [190118] (12 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [189560] (94 PDB entries)

8. Domain d2d07b_: 2d07 B: [131063]
   Other proteins in same PDB: d2d07a_
   automated match to d1wm2a_

Details for d2d07b_

PDB Entry: 2d07, 2.1 Å

PDB Description: Crystal Structure of SUMO-3-modified Thymine-DNA Glycosylase

PDB Compounds: (B:) Ubiquitin-like protein SMT3B

SCOPe Domain Sequences for d2d07b_:

Sequence; same for both SEQRES and ATOM records:

>d2d07b_ d.15.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ndhinlkvagqdgsvvqfkikrhtplsklmkaycerqglsmrqirfrfdgqpinetdtpa
qlemededtidvfqqq

Timeline for d2d07b_:

• d2d07b_ first appeared in SCOP 1.73, called d2d07b1
  
• d2d07b_ appears in SCOPe 2.05
  
• d2d07b_ appears in SCOPe 2.07
  
• d2d07b_ appears in the current release, SCOPe 2.08