Lineage for d2d03h1 (2d03 H:120-220)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 651987Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 651988Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 654118Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)
  6. 655111Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (5 species)
  7. 655348Species Mouse (Mus musculus) [TaxId:10090] [88576] (330 PDB entries)
  8. 655424Domain d2d03h1: 2d03 H:120-220 [131060]
    automatically matched to d1fnsh2
    complexed with gol, mes, peg; mutant

Details for d2d03h1

PDB Entry: 2d03 (more details), 1.97 Å

PDB Description: Crystal structure of the G91S mutant of the NNA7 Fab
PDB Compounds: (H:) anti-glycophorin A type N immunoglobulin heavy chain

SCOP Domain Sequences for d2d03h1:

Sequence, based on SEQRES records: (download)

>d2d03h1 b.1.1.2 (H:120-220) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Mouse (Mus musculus) [TaxId: 10090]}
akttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsd
lytlsssvtvpsstwpsetvtcnvahpasstkvdkkivprd

Sequence, based on observed residues (ATOM records): (download)

>d2d03h1 b.1.1.2 (H:120-220) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Mouse (Mus musculus) [TaxId: 10090]}
akttppsvyplapgsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdlytlss
svtvpsstwpsetvtcnvahpasstkvdkkivprd

SCOP Domain Coordinates for d2d03h1:

Click to download the PDB-style file with coordinates for d2d03h1.
(The format of our PDB-style files is described here.)

Timeline for d2d03h1: