SCOP 1.73: Domain d2d03h1: 2d03 H:120-220

Lineage for d2d03h1 (2d03 H:120-220)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)

6. Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (5 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [88576] (330 PDB entries)

8. Domain d2d03h1: 2d03 H:120-220 [131060]
   automatically matched to d1fnsh2
   complexed with gol, mes, peg; mutant

Details for d2d03h1

PDB Entry: 2d03, 1.97 Å

PDB Description: Crystal structure of the G91S mutant of the NNA7 Fab

PDB Compounds: (H:) anti-glycophorin A type N immunoglobulin heavy chain

SCOP Domain Sequences for d2d03h1:

Sequence, based on SEQRES records:

>d2d03h1 b.1.1.2 (H:120-220) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Mouse (Mus musculus) [TaxId: 10090]}
akttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsd
lytlsssvtvpsstwpsetvtcnvahpasstkvdkkivprd

Sequence, based on observed residues (ATOM records):

>d2d03h1 b.1.1.2 (H:120-220) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Mouse (Mus musculus) [TaxId: 10090]}
akttppsvyplapgsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdlytlss
svtvpsstwpsetvtcnvahpasstkvdkkivprd

Timeline for d2d03h1:

• d2d03h1 is new in SCOP 1.73
  
• d2d03h1 appears in SCOP 1.75
  
• d2d03h1 appears in the current release, SCOPe 2.08, called d2d03h_