SCOP 1.73: Domain d2d01a1: 2d01 A:2-125

Lineage for d2d01a1 (2d01 A:2-125)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.110: Profilin-like [55769] (9 superfamilies)
   core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha

4. Superfamily d.110.3: PYP-like sensor domain (PAS domain) [55785] (6 families)
   alpha-beta(2)-alpha(2)-beta(3)

5. Family d.110.3.1: PYP-like [55786] (2 proteins)

6. Protein Photoactive yellow protein, PYP [55787] (1 species)

7. Species Ectothiorhodospira halophila [TaxId:17] [55788] (40 PDB entries)

8. Domain d2d01a1: 2d01 A:2-125 [131059]
   automatically matched to d1nwza_
   complexed with hc4

Details for d2d01a1

PDB Entry: 2d01, 1.34 Å

PDB Description: Wild Type Photoactive Yellow Protein, P65 Form

PDB Compounds: (A:) Photoactive yellow protein

SCOP Domain Sequences for d2d01a1:

Sequence; same for both SEQRES and ATOM records:

>d2d01a1 d.110.3.1 (A:2-125) Photoactive yellow protein, PYP {Ectothiorhodospira halophila [TaxId: 1053]}
ehvafgsedientlakmddgqldglafgaiqldgdgnilqynaaegditgrdpkqvigkn
ffkdvapctdspefygkfkegvasgnlntmfeytfdyqmtptkvkvhmkkalsgdsywvf
vkrv

Timeline for d2d01a1:

• d2d01a1 is new in SCOP 1.73
  
• d2d01a1 appears in SCOP 1.75
  
• d2d01a1 appears in the current release, SCOPe 2.08, called d2d01a_