Class d: Alpha and beta proteins (a+b) [53931] (334 folds) |
Fold d.79: Bacillus chorismate mutase-like [55297] (7 superfamilies) core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest |
Superfamily d.79.3: L30e-like [55315] (3 families) |
Family d.79.3.1: L30e/L7ae ribosomal proteins [55316] (3 proteins) |
Protein Ribosomal protein L7ae [55319] (4 species) |
Species Archaeon Pyrococcus abyssi [TaxId:29292] [103081] (2 PDB entries) |
Domain d2czwa1: 2czw A:7-124 [131058] automatically matched to d1pxwa_ |
PDB Entry: 2czw (more details), 1.9 Å
SCOP Domain Sequences for d2czwa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2czwa1 d.79.3.1 (A:7-124) Ribosomal protein L7ae {Archaeon Pyrococcus abyssi [TaxId: 29292]} yvkfevpkelaekalqaveiardtgkirkgtnettkavergqaklviiaedvdpeeivah lpplceekeipyiyvpskkelgaaagievaaasvaiiepgkardlveeiamkvrelmk
Timeline for d2czwa1: