Lineage for d2cz6b1 (2cz6 B:1-211)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 665027Fold b.34: SH3-like barrel [50036] (18 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 665462Superfamily b.34.4: Electron transport accessory proteins [50090] (4 families) (S)
  5. 665485Family b.34.4.4: Nitrile hydratase beta chain [50101] (2 proteins)
    contains irregular array of helices in the N-terminal extension
  6. 665495Protein Iron-containing nitrile hydratase [50102] (1 species)
  7. 665496Species Rhodococcus erythropolis [TaxId:1833] [50103] (8 PDB entries)
    also Rhodococcus sp. R312
  8. 665498Domain d2cz6b1: 2cz6 B:1-211 [131041]
    Other proteins in same PDB: d2cz6a1
    automatically matched to d2ahjd_
    complexed with cyi, fe, mg, no

Details for d2cz6b1

PDB Entry: 2cz6 (more details), 1.5 Å

PDB Description: Complex of Inactive Fe-type NHase with Cyclohexyl isocyanide
PDB Compounds: (B:) Nitrile hydratase subunit beta

SCOP Domain Sequences for d2cz6b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2cz6b1 b.34.4.4 (B:1-211) Iron-containing nitrile hydratase {Rhodococcus erythropolis [TaxId: 1833]}
mdgvhdlagvqgfgkvphtvnadigptfhaewehlpyslmfagvaelgafsvdevryvve
rmeprhymmtpyyeryvigvatlmvekgiltqdeleslaggpfplsrpsesegrpapvet
ttfevgqrvrvrdeyvpghirmpaycrgrvgtishrttekwpfpdaighgrndageepty
hvkfaaeelfgsdtdggsvvvdlfegylepa

SCOP Domain Coordinates for d2cz6b1:

Click to download the PDB-style file with coordinates for d2cz6b1.
(The format of our PDB-style files is described here.)

Timeline for d2cz6b1: