Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) division into families based on beta-sheet topologies |
Family c.37.1.8: G proteins [52592] (79 proteins) core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest |
Protein automated matches [190047] (29 species) not a true protein |
Species Pyrococcus horikoshii OT3 [TaxId:70601] [187582] (1 PDB entry) |
Domain d2cxxc_: 2cxx C: [131015] Other proteins in same PDB: d2cxxa1 automated match to d2cxxa1 complexed with gdp |
PDB Entry: 2cxx (more details), 1.7 Å
SCOPe Domain Sequences for d2cxxc_:
Sequence, based on SEQRES records: (download)
>d2cxxc_ c.37.1.8 (C:) automated matches {Pyrococcus horikoshii OT3 [TaxId: 70601]} atiifagrsnvgkstliyrltgkkvrrgkrpgvtrkiieiewknhkiidmpgfgfmmglp kevqerikdeivhfiednaknidvavlvvdgkaapeiikrwekrgeipidvefyqflrel diptivavnkldkiknvqevinflaekfevplseidkvfipisakfgdnierlknrifev irer
>d2cxxc_ c.37.1.8 (C:) automated matches {Pyrococcus horikoshii OT3 [TaxId: 70601]} atiifagrsnvgkstliyrltgkkvrgvtrkiieiewknhkiidmpgfgfmmglpkevqe rikdeivhfiednaknidvavlvvdgkaapeiikrwekrgeipidvefyqflreldipti vavnkldkiknvqevinflaekfevplseidkvfipisakfgdnierlknrifevirer
Timeline for d2cxxc_: