SCOP 1.73: Domain d2cxed2: 2cxe D:9-133

Lineage for d2cxed2 (2cxe D:9-133)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.58: Ferredoxin-like [54861] (55 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.9: RuBisCO, large subunit, small (N-terminal) domain [54966] (1 family)
   C-terminal domain is beta/alpha barrel

5. Family d.58.9.1: Ribulose 1,5-bisphosphate carboxylase-oxygenase [54967] (1 protein)

6. Protein Ribulose 1,5-bisphosphate carboxylase-oxygenase [54968] (12 species)

7. Species Archaeon Pyrococcus horikoshii [TaxId:53953] [143363] (3 PDB entries)

8. Domain d2cxed2: 2cxe D:9-133 [131003]
   Other proteins in same PDB: d2cxea1, d2cxeb1, d2cxec1, d2cxed1
   automatically matched to 2CWX A:8-133

Details for d2cxed2

PDB Entry: 2cxe, 3 Å

PDB Description: Crystal structure of octameric ribulose-1,5-bisphosphate carboxylase/oxygenase (Rubisco) from Pyrococcus horikoshii OT3 (form-2 crystal)

PDB Compounds: (D:) Ribulose bisphosphate carboxylase

SCOP Domain Sequences for d2cxed2:

Sequence; same for both SEQRES and ATOM records:

>d2cxed2 d.58.9.1 (D:9-133) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Archaeon Pyrococcus horikoshii [TaxId: 53953]}
ewyldfvdlnyepgrdeliveyyfepngvspeeaagriasessigtwttlwklpemakrs
makvfylekhgegyiakiaypltlfeegslvqlfsavagnvfgmkalknlrlldfhppye
ylrhf

Timeline for d2cxed2:

• d2cxed2 is new in SCOP 1.73
  
• d2cxed2 appears in SCOP 1.75
  
• d2cxed2 appears in the current release, SCOPe 2.08