Lineage for d2cxeb2 (2cxe B:9-133)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 861003Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 862528Superfamily d.58.9: RuBisCO, large subunit, small (N-terminal) domain [54966] (1 family) (S)
    C-terminal domain is beta/alpha barrel
  5. 862529Family d.58.9.1: Ribulose 1,5-bisphosphate carboxylase-oxygenase [54967] (1 protein)
  6. 862530Protein Ribulose 1,5-bisphosphate carboxylase-oxygenase [54968] (12 species)
  7. 862538Species Archaeon Pyrococcus horikoshii [TaxId:53953] [143363] (3 PDB entries)
    Uniprot O58677 8-133
  8. 862546Domain d2cxeb2: 2cxe B:9-133 [130999]
    Other proteins in same PDB: d2cxea1, d2cxeb1, d2cxec1, d2cxed1
    automatically matched to 2CWX A:8-133

Details for d2cxeb2

PDB Entry: 2cxe (more details), 3 Å

PDB Description: Crystal structure of octameric ribulose-1,5-bisphosphate carboxylase/oxygenase (Rubisco) from Pyrococcus horikoshii OT3 (form-2 crystal)
PDB Compounds: (B:) Ribulose bisphosphate carboxylase

SCOP Domain Sequences for d2cxeb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2cxeb2 d.58.9.1 (B:9-133) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Archaeon Pyrococcus horikoshii [TaxId: 53953]}
ewyldfvdlnyepgrdeliveyyfepngvspeeaagriasessigtwttlwklpemakrs
makvfylekhgegyiakiaypltlfeegslvqlfsavagnvfgmkalknlrlldfhppye
ylrhf

SCOP Domain Coordinates for d2cxeb2:

Click to download the PDB-style file with coordinates for d2cxeb2.
(The format of our PDB-style files is described here.)

Timeline for d2cxeb2: