Class e: Multi-domain proteins (alpha and beta) [56572] (68 folds) |
Fold e.6: Acyl-CoA dehydrogenase NM domain-like [56644] (1 superfamily) 2 domains: (1) all-alpha: 5 helices; (2) contains an open beta-sheet barrel: n*=5, S*=8; complex topology |
Superfamily e.6.1: Acyl-CoA dehydrogenase NM domain-like [56645] (3 families) flavoprotein: binds FAD; constituent families differ in the numbers of C-terminal domains (four-helical bundles) |
Family e.6.1.1: Medium chain acyl-CoA dehydrogenase, NM (N-terminal and middle) domains [56646] (10 proteins) |
Protein Acyl-CoA dehydrogenase [144024] (1 species) |
Species Thermus thermophilus [TaxId:274] [144025] (3 PDB entries) Uniprot Q5SGZ2 2-234 |
Domain d2cx9d2: 2cx9 D:3-234 [130992] Other proteins in same PDB: d2cx9a1, d2cx9b1, d2cx9c1, d2cx9d1 automated match to d1ws9a2 complexed with cl |
PDB Entry: 2cx9 (more details), 2 Å
SCOPe Domain Sequences for d2cx9d2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2cx9d2 e.6.1.1 (D:3-234) Acyl-CoA dehydrogenase {Thermus thermophilus [TaxId: 274]} lwfeegaeerqvlgpfreflkaevapgaaerdrtgafpwdlvrklaefgvfgalvpeayg gaglstrlfarmveaiayydgalaltvashnslatghillagseaqkeaflpklasgeal gawgltepgsgsdaaalktkaekveggwrlngtkqfitqgsvagvyvvmartdpppsper khqgisafaffrperglkvgrkeeklgltasdtaqliledlfvpeeallger
Timeline for d2cx9d2: