Class a: All alpha proteins [46456] (290 folds) |
Fold a.29: Bromodomain-like [47363] (15 superfamilies) 4 helices; bundle; minor mirror variant of up-and-down topology |
Superfamily a.29.3: Acyl-CoA dehydrogenase C-terminal domain-like [47203] (3 families) multidomain flavoprotein; N-terminal domain is all-alpha; the middle domain is open (5,8) barrel |
Family a.29.3.1: Medium chain acyl-CoA dehydrogenase-like, C-terminal domain [47204] (10 proteins) |
Protein Acyl-CoA dehydrogenase [140473] (1 species) |
Species Thermus thermophilus [TaxId:274] [140474] (3 PDB entries) Uniprot Q5SGZ2 235-387 |
Domain d2cx9c1: 2cx9 C:235-387 [130989] Other proteins in same PDB: d2cx9a2, d2cx9b2, d2cx9c2, d2cx9d2 automated match to d1ws9a1 complexed with cl |
PDB Entry: 2cx9 (more details), 2 Å
SCOPe Domain Sequences for d2cx9c1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2cx9c1 a.29.3.1 (C:235-387) Acyl-CoA dehydrogenase {Thermus thermophilus [TaxId: 274]} gkgfydvlrvldggrigiaamavglgqaaldyalayakgreafgrpiaefegvsfklaea ateleaarllylkaaelkdagrpftleaaqaklfaseaavkacdeaiqilggygyvkdyp verywrdarltrigegtseilklviarrlleav
Timeline for d2cx9c1: