Lineage for d2cx9b1 (2cx9 B:235-387)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1993780Fold a.29: Bromodomain-like [47363] (15 superfamilies)
    4 helices; bundle; minor mirror variant of up-and-down topology
  4. 1994829Superfamily a.29.3: Acyl-CoA dehydrogenase C-terminal domain-like [47203] (3 families) (S)
    multidomain flavoprotein; N-terminal domain is all-alpha; the middle domain is open (5,8) barrel
  5. 1994830Family a.29.3.1: Medium chain acyl-CoA dehydrogenase-like, C-terminal domain [47204] (10 proteins)
  6. 1994837Protein Acyl-CoA dehydrogenase [140473] (1 species)
  7. 1994838Species Thermus thermophilus [TaxId:274] [140474] (3 PDB entries)
    Uniprot Q5SGZ2 235-387
  8. 1994842Domain d2cx9b1: 2cx9 B:235-387 [130987]
    Other proteins in same PDB: d2cx9a2, d2cx9b2, d2cx9c2, d2cx9d2
    automated match to d1ws9a1
    complexed with cl

Details for d2cx9b1

PDB Entry: 2cx9 (more details), 2 Å

PDB Description: crystal structure of acyl-coa dehydrogenase
PDB Compounds: (B:) acyl-CoA dehydrogenase

SCOPe Domain Sequences for d2cx9b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2cx9b1 a.29.3.1 (B:235-387) Acyl-CoA dehydrogenase {Thermus thermophilus [TaxId: 274]}
gkgfydvlrvldggrigiaamavglgqaaldyalayakgreafgrpiaefegvsfklaea
ateleaarllylkaaelkdagrpftleaaqaklfaseaavkacdeaiqilggygyvkdyp
verywrdarltrigegtseilklviarrlleav

SCOPe Domain Coordinates for d2cx9b1:

Click to download the PDB-style file with coordinates for d2cx9b1.
(The format of our PDB-style files is described here.)

Timeline for d2cx9b1: